SUPERFAMILY 1.75 HMM library and genome assignments server

  Home > Genomes > Vibrio vulnificus CMCP6 > gi|27364164|ref|NP_759692.1|

Domain assignment for gi|27364164|ref|NP_759692.1| from Vibrio vulnificus CMCP6

Domain architecture

Domain assignment details

(show help)

No Significant Hits.

Protein sequence

External link(s) gi|27364164|ref|NP_759692.1|
Sequence length 119
Comment hypothetical protein VV1_0709 [Vibrio vulnificus CMCP6]
Sequence 
MKALVLTFPLLLLVGCVQTPLPQSEQALDWHTFGVESALEGKIALSEARLLKLAEPRNLS
ANLLASYQAGYQEGKQQYCQQNAYMLGVIGKPYYGICDDVDPFFKQDYISGQMSTAGGL
Download sequence
Identical sequences Q8DE88
216895.VV1_0709 gi|27364164|ref|NP_759692.1|

Jump to [ Top of page · Domain architecture · Domain assignment details ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.