SUPERFAMILY 1.75 HMM library and genome assignments server

  Home > Genomes > Vibrio vulnificus CMCP6 > gi|27363758|ref|NP_759286.1|

Domain assignment for gi|27363758|ref|NP_759286.1| from Vibrio vulnificus CMCP6

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  gi|27363758|ref|NP_759286.1|
Domain Number 1 Region: 186-258
Classification Level Classification E-value
Superfamily Sporulation related repeat 1.09e-11
Family Sporulation related repeat 0.004
Further Details:      
 
Domain Number 2 Region: 83-171
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 1.12e-10
Family Barwin 0.063
Further Details:      
 

Protein sequence

External link(s) gi|27363758|ref|NP_759286.1|
Sequence length 264
Comment Rare lipoprotein A [Vibrio vulnificus CMCP6]
Sequence 
MNKSIVIFSLLCGASLLAGCSSKPEGRYSLESDVAPDQPISVEHIEDAHPRYEPYSLGGN
KDYTLRGQDYKIVRDVKGFKESGIASWYGKKFQGHLTSNGEIYDMYSMTAAHKTLPLPSY
VKVTNKDNGKSTIVRVNDRGPFHEGRIIDLSYAAAYKLDVLKTGTANVEIEVLNFEPPTD
AKALENHPKYFIQVLSSKSAERARTLGQDLGQSLNVDSFLESTDDTHRLMLGPFTDFTLT
QQILDQVKLAGHESAFIRKRAITR
Download sequence
Identical sequences Q8DFD5
216895.VV1_0280 gi|27363758|ref|NP_759286.1|

Jump to [ Top of page · Domain architecture · Domain assignment details ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.