SUPERFAMILY 1.75 HMM library and genome assignments server

  Home > Genomes > Leptospira interrogans serovar Lai str. 56601 > gi|24214869|ref|NP_712350.1|

Domain assignment for gi|24214869|ref|NP_712350.1| from Leptospira interrogans serovar Lai str. 56601

Domain architecture

Domain assignment details

(show help)

No Significant Hits.

Protein sequence

External link(s) gi|24214869|ref|NP_712350.1|
Sequence length 58
Comment lipoprotein [Leptospira interrogans serovar Lai str. 56601]
Sequence 
MILKLSLYILIFICLAACSNQNDSDLFWLEWGRLRKVETHFSFSGRFVPAFKKKECKR
Download sequence
Identical sequences G7QKU1 Q8F476
189518.LA2169 gi|386074227|ref|YP_005988544.1| gi|24214869|ref|NP_712350.1|

Jump to [ Top of page · Domain architecture · Domain assignment details ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.