SUPERFAMILY 1.75 HMM library and genome assignments server

Home > Genomes > Bacteroides thetaiotaomicron VPI-5482 > gi|29347272|ref|NP_810775.1|

Domain assignment for gi|29347272|ref|NP_810775.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture

Domain assignment details

No Significant Hits.

Weak hits

Sequence:	gi\|29347272\|ref\|NP_810775.1\|
Domain Number -	Region: 46-75
Classification Level	Classification	E-value
Superfamily	Phospholipase A2, PLA2	0.0165
Family	Vertebrate phospholipase A2	0.031
Further Details:

Protein sequence

External link(s)	gi\|29347272\|ref\|NP_810775.1\|
Sequence length	80
Comment	hypothetical protein BT_1862 [Bacteroides thetaiotaomicron VPI-5482]
Sequence	MKTKLFLAAVAVTFSFAVISCSGNKANNAAASEGEEATVETVEAVAVEATDSCCQAKDSC ATACDKKADCTEKKECCDKK
Download sequence
Identical sequences	C6IRQ8 D7IIG3 Q8A6L5 226186.BT_1862 gi\|29347272\|ref\|NP_810775.1\|

Jump to [ Top of page · Domain architecture · Domain assignment details ]