SUPERFAMILY 1.75 HMM library and genome assignments server

  Home > Genomes > Bacteroides thetaiotaomicron VPI-5482 > gi|29346240|ref|NP_809743.1|

Domain assignment for gi|29346240|ref|NP_809743.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture

Domain assignment details

(show help)

No Significant Hits.

Weak hits

Sequence:  gi|29346240|ref|NP_809743.1|
Domain Number - Region: 138-194
Classification Level Classification E-value
Superfamily Bacterial adhesins 0.0572
Family Fibrinogen-binding domain 0.012
Further Details:      
 

Protein sequence

External link(s) gi|29346240|ref|NP_809743.1|
Sequence length 265
Comment hypothetical protein BT_0830 [Bacteroides thetaiotaomicron VPI-5482]
Sequence 
MTKYVAISLVAILLAACNSSKNPHSSSGQEEDLSAKELLQGIWLDDETESPLMRIEGDTI
YYADSQSAPITFKIIRDTLYTYGNDTTYYKIDKQGEHIFWFHSIADNMIRLHKSEDPNDS
LSFVGQEMIIPTYTEVTKRDSIVNYNGSRYRAYVYINPSKMRVIKTIYTEDGISMDNVYY
DNVMHICVYEGKKSLFASDITKQMFESVVPADFLVQAILSDTKFVKVDRNGFHYQAVLSI
PESSIYSIANLTVSFSGKLTITPTK
Download sequence
Identical sequences Q8A9I5
226186.BT_0830 gi|29346240|ref|NP_809743.1|

Jump to [ Top of page · Domain architecture · Domain assignment details ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.