SUPERFAMILY 1.75 HMM library and genome assignments server

  Home > Genomes > Bacteroides thetaiotaomicron VPI-5482 > gi|29345529|ref|NP_809032.1|

Domain assignment for gi|29345529|ref|NP_809032.1| from Bacteroides thetaiotaomicron VPI-5482

Domain architecture

Domain assignment details

(show help)

No Significant Hits.

Weak hits

Sequence:  gi|29345529|ref|NP_809032.1|
Domain Number - Region: 1-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000405
Family PDI-like 0.044
Further Details:      
 

Protein sequence

External link(s) gi|29345529|ref|NP_809032.1|
Sequence length 147
Comment hypothetical protein BT_0119 [Bacteroides thetaiotaomicron VPI-5482]
Sequence 
MKKLFYLLIATIVLISCGNGSKNKTETSIAKENQTNRVEVLYFHGAQRCITCRAIEANTV
ALLDSLYSKEQADGKIIFKVIDISKKENEQIADKYEVTWSSLFVNGWKDSKENVNNMTEF
SFSNARNEPDKFKEGIKNKIDELLKTL
Download sequence
Identical sequences B7AMS8 D6D3B5 Q8ABJ1
226186.BT_0119 gi|29345529|ref|NP_809032.1|

Jump to [ Top of page · Domain architecture · Domain assignment details ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.